McAfee Total Protection 5-Device | AntiVirus Software 2026 for Windows PC & Mac, AI Scam Detection, VPN, Password Manager, Identity Monitoring | 1-Year Subscription with Auto-Renewal | Download
$29.99
Features
MCAFEE TOTAL PROTECTION IS ALL-IN-ONE PROTECTION – antivirus, security, identity, and privacy protection for 5 devices for 1 year
SECURE VPN – Stay private and secure on public Wi-Fi with VPN that can connect automatically when you need it
MONITOR UP TO 10 EMAILS ON THE DARK WEB - If your info is found we'll notify you so you can act before your info ends up in the wrong hands
CHECK THE HEALTH OF YOUR ONLINE PROTECTION – our industry-first Protection Score will identify weak spots and guide you to improve your security
PASSWORD MANAGER - Secure your accounts by generating and storing complex passwords and auto-filling your info for faster logins across devices
AWARD WINNING ANTIVIRUS - Protect up to 5 personal devices and the info on them from the latest threats
Details
PreyurdevesdpersfrmwhfdeeusgMfeePre2023!hs--eyberseurysfwrepkgeffersvrus,seureVP,psswrdmger,ddrkwebmrgesuremprehesveprefrup5deves.Whdusry-edgseuryfeures,resssuredhyurevesreshededfrmyberhresdprvybrehes.
Sfegurdyureprvyyme,ywherewhheseureVPudedMfeePre.Wheheryu'reusgpubW-Frmggsesverss,heVPesuresyurdremsprvedseure.Ejyheveeedpeefmdkwghyurereeserypeddshededfrmprygeyes.
Syhedfyberrmsbymrgup10emshedrkwebwhMfeePre.Reeveersfyurfrmsmprmsed,wgyukeprvesepsprevedeyhefduuhrzedess.D'wu'se-kerfyurdgfprdpreyursesvedeffevey.
kehrgefyureseurywhMfee'svvePreSre,desgedssessdeheyurdevepre.defyvuerbesyuryberseurymesuresdreeveperszedremmedsfrfyyurdefeses.WhMfeePre,yuhvehepwersregheyurdgrmrdsyesephedfevvghres.
FrgehehssefmggpsswrdswhheegredpsswrdmgerMfeePre.Geere,sre,du-fmpexpsswrdsrssyurdeveseffressy,ehgyuruseurydsremgyurgexperee.Sygdbyewekpsswrdsdembresrg,uquepssphrsesfrhegheedpregsruders.
D'mprmseheseuryfyurvubed-rusMfee'swrd-wgvrussushedup5persdevesfrmheesyberhres.Preyurdgssesdfdefrmwhprvehredeedre-mesg,esurghyurdevesremsfegurdedrudhek.EeveyuryberseurydefeseswhMfeePredy!
Discover More Best Sellers in Software
Shop Software![Software - CorelDRAW Graphics Suite | 1 Month Subscription | Graphic Design Software for Professionals | Vector Illustration, Layout, and Image Editing [ PC/Mac Download]](https://images-na.ssl-images-amazon.com/images/I/719f+DNTMzL._AC_SL1500_.jpg)
![3.40 of 5 Stars: Software - CorelDRAW Graphics Suite | 1 Month Subscription | Graphic Design Software for Professionals | Vector Illustration, Layout, and Image Editing [ PC/Mac Download]](/images/rate3.svg)
![Software - CorelDRAW Graphics Suite | 1 Month Subscription | Graphic Design Software for Professionals | Vector Illustration, Layout, and Image Editing [ PC/Mac Download]](/images/blank.gif)
Software - CorelDRAW Graphics Suite | 1 Month Subscription | Graphic Design Software for Professionals | Vector Illustration, Layout, and Image Editing [ PC/Mac Download]
Software - Creative Cloud Photography Plan 20GB (Photoshop + Lightroom) | 12-month Subscription with auto-renewal
Software - Slideshow Studio for Windows 11, 10, 8.1, 7 - Turn your wedding, birthday and vacation photos into beautiful videos with music, transitions and effects
Software - Chrome Enterprise Upgrade | 1-Year Subscription | Up to 10 Licenses per Domain | Available for new Chrome Enterprise customers
![Software - TurboTax Home & Business Desktop Edition 2025, Federal & State Tax Return [PC/Mac Download]](https://m.media-amazon.com/images/I/41g5u0+-GVL._SL500_.jpg._AC_SL1500_.jpg)
TurboTax Home & Business Desktop Edition 2025, Federal & State Tax Return [PC/Mac Download]
Software - TurboTax Home & Business Desktop Edition 2025, Federal & State Tax Return [PC/Mac Download]
Software - Kaspersky Plus Internet Security 2023 | 1 Device | 1 Year | Anti-Phishing and Firewall | Unlimited VPN | Password Manager | Online Banking Protection | PC/Mac/Mobile | Online Code
Webroot Antivirus for PC Gamers 2025 | 1 Device | 1 Year Download + System Performance Optimizer
Software - Webroot Antivirus for PC Gamers 2025 | 1 Device | 1 Year Download + System Performance Optimizer
![Software - [Old Version] TurboTax Deluxe 2020 Desktop Tax Software, Federal Returns Only + Federal E-file [Amazon Exclusive] [PC Download]](https://images-na.ssl-images-amazon.com/images/I/71ziEfCF39L._AC_SL1500_.jpg)
![4.60 of 5 Stars: Software - [Old Version] TurboTax Deluxe 2020 Desktop Tax Software, Federal Returns Only + Federal E-file [Amazon Exclusive] [PC Download]](/images/rate4h.svg)
Software - [Old Version] TurboTax Deluxe 2020 Desktop Tax Software, Federal Returns Only + Federal E-file [Amazon Exclusive] [PC Download]
